PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF063900020CFD_t1
Common NameTRAES_3BF063900020CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 230aa    MW: 24433.9 Da    PI: 9.08
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF063900020CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.94e-373488559
                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                             + +cprC+st+tkfCyynny+lsqPr+fCk+CrryWt+GGalrnvPvGg++rk +
  TRAES3BF063900020CFD_t1 34 QCPCPRCESTDTKFCYYNNYNLSQPRHFCKGCRRYWTRGGALRNVPVGGATRKPN 88
                             679*************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-223488IPR003851Zinc finger, Dof-type
PfamPF027016.0E-313587IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.363589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDQLEAEEVV VRAPAPTAAS GGVRRAGEPE RLAQCPCPRC ESTDTKFCYY NNYNLSQPRH  60
FCKGCRRYWT RGGALRNVPV GGATRKPNGS PAGVRRKRPS HSHSNSHHAA SSQAAPVVPL  120
SVSAPAPLPL PLLPPPQPQP QQYELTFLPP SLSAVDPDRR LLDLGGSFSS LLAPPAPLLP  180
NFATSFVFGG AGAGMAMAHA HVPALPQPAP VVSQALPESF WGMGWPDLSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753871.15e-52PREDICTED: dof zinc finger protein DOF3.1
TrEMBLA0A077RRL91e-166A0A077RRL9_WHEAT; Uncharacterized protein
STRINGGRMZM2G378490_P011e-49(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-31DOF zinc finger protein 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]